8RK1A

Crystal structure of futa bound to fe(iii) solved by neutron diffraction
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
312
structure length
312
Chain Sequence
KEVKVYSGRHYNTDKEVYQKFQEQTGIKVRYIETDGKAIIERLKREGKNSQADLVILVDAAIIENASKANLFQKINSNFLENSVPNNLRDPRNKWFGLTRRLRVIISNPDIVDITKIKNFEDLTNPSFKGKVCLRNRKSPYNQSLVSNQIAKKGVGQTKIWLKGLISNVSTPYFSGDSSLIRAVGLGTCGIGIVNHYYVARMLDGVKGPRDASLAEKIKLIIPNPAHVNITAGGVYKYAENKTEAIKLLEYLASSEGSQGLANKTYEHPLKESSQNRIVSKFGDFTPDNVTIKELGKFNSKAIEIMKEVGWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Putative iron ABC transporter, substrate binding protein
publication title A redox switch allows binding of Fe(II) and Fe(III) ions in the cyanobacterial iron binding protein FutA from Prochlorococcus
rcsb
source organism Prochlorococcus marinus subsp. pastoris str. ccmp1986
total genus 113
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2023-12-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...