8RKIC

Molecular basis of zp3/zp1 heteropolymerization: crystal structure of a native vertebrate egg coat filament fragment
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
155
structure length
155
Chain Sequence
CEVPRDVRVPCGVPDISPSACDAIDCCHDGQSCYFGTGATVQCTKDGHFIVVVAKDVTLPHIDLETISLLGQGQDCGPADSNSAFAIYYFPVTYCGTVVMEEPGVIVYENRMTSSYEVGVGPLGAITRDSSFELLFQCRYRATSVETLVVEVQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Zona pellucida sperm-binding protein 3
publication title ZP2 cleavage blocks polyspermy by modulating the architecture of the egg coat
doi rcsb
total genus 17
structure length 155
sequence length 155
ec nomenclature ec ?:
pdb deposition date 2023-12-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...