8ROYD

Structure of the human ddb1-dda1-dcaf15 e3 ubiquitin ligase bound to compound furan 24
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
57
Chain Sequence
FLKGLPVYNKSNFSRFHARRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Optimization of Potent Ligands for the E3 Ligase DCAF15 and Evaluation of Their Use in Heterobifunctional Degraders.
pubmed doi rcsb
molecule tags Ligase
source organism Homo sapiens
molecule keywords DDB1- and CUL4-associated factor 15
total genus 7
structure length 57
sequence length 65
ec nomenclature
pdb deposition date 2024-01-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...