8RTFA

Crystal structure of trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (tcopyk-sdab42)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
499
structure length
499
Chain Sequence
SQLQHNIGLSIFEPVAKHRANRIICTIGPSTQSVEALKGLMKSGMSVARMNFSHGSYEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEATYAPGDTVLVTTDPAFEKIGTKEKFYVDYPQLPNVVRPGGLIYVDDGVLTLRVLSKEDDCTLKCHVNNHHRLTDRKGINLPGCEVDLPAVSEKDRKDLQFGVEQGVDMIFASFIRTADQVREVRAALGEKGKDTLIISKIENHQGVQNIDAIIEASDGIMVARGDLGVEIPAEKVVVAQMCIISKCNVAGKPVICATQMLESMTTNPRPTRAEVTDVANAVFNGADCVMLSGETAKGKYPNEVVQYMVRICIEAQSATHDSVMFNSIKNLQKIPMSPEEAVCSSAVSSAFEVQAKAILVLSNTGRSARLISKYRPNCPIICATTRLLTCRQLNVTRSVESVYYDVDAHGEDNDREKRVQLGVDWAKTKGYVSAGDVMVIVHADHSVKGYPNQTRLVRVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric inhibition of trypanosomatid pyruvate kinases by a camelid single-domain antibody.
pubmed doi rcsb
molecule keywords Pyruvate kinase
molecule tags Transferase
source organism Trypanosoma congolense
total genus 164
structure length 499
sequence length 499
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.40: pyruvate kinase.
pdb deposition date 2024-01-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...