8RXBA

Human upf1 ch domain in complex with smg6 peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
159
structure length
147
Chain Sequence
KDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPASVVVLLCRQPCASQSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title UPF1 helicase orchestrates mutually exclusive interactions with the SMG6 endonuclease and UPF2.
pubmed doi rcsb
molecule keywords Regulator of nonsense transcripts 1
molecule tags Rna binding protein
source organism Homo sapiens
total genus 28
structure length 147
sequence length 159
chains with identical sequence D, E, I, L, P
ec nomenclature
pdb deposition date 2024-02-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...