8RXHLb

Cryo-em structure of leishmania major 80s ribosome with a/p/e-site trna and mrna : parental strain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
68
structure length
68
Chain Sequence
AKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNARRVRKHNQKAALKKRRERIAAFAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification
doi rcsb
molecule tags Ribosome
molecule keywords LSUa_rRNA_chain_1
total genus 16
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2024-02-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...