8S36G

Dna-bound type iv-a3 crispr effector in complex with ding helicase from k. pneumoniae (state ii)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
263
structure length
263
Chain Sequence
MNHPVESVYSALTSILLPYMGEPVPVQRNCSCCGRAPSEFDGVGFELVNAYRERVVHCRPCQTFFVSAPELMGVENPKKPTTGQKFGMWSGVGAVINVEDNSSVLLAPQGVVNKLPEHFFDHVEVITATSGQHLEYLFNTELKFPLIYIQNFGVKTYELVRSLRVSLSADAIYTCADQLLTRQNEVLYMLDLKKAKELHQEIKNYSKKEMDIFIRTVTLLAYSRITPEAASNEFKKNNLIPLLLLLPTDPHQRLSILHLLKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural variation of types IV-A1- and IV-A3-mediated CRISPR interference.
pubmed doi rcsb
molecule keywords CRISPR type AFERR-associated protein Csf2
molecule tags Antiviral protein
source organism Klebsiella pneumoniae
total genus 61
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2024-02-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...