8S9OA

Dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - p1 crystal form
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
258
structure length
230
Chain Sequence
SNSDSFQKKKLKSFTNKYVVLDSLEGLRSLPDNSVQCVVTSPPYNKLNEDDYQKWQLQILNEINRILKPGGSAFYNHKDHPPEKFLSDSDLELYQTIIWDRGSTVNQNARYFRPYVEKIFWFTKSISGESTTPKFHRDRLPEYFKGVIWRIPPDKRNKHPAPFPAILAEICILTTTEEGDLVLDPFAGSGTTLVAAASLKRSYLGFDISSKYQKMFHQRLATSKSKVHLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords DNA cytosine-N4 methyltransferase
publication title Biochemical and structural characterization of the first-discovered metazoan DNA cytosine-N4 methyltransferase from the Bdelloid rotifer Adineta vaga.
pubmed doi rcsb
source organism Adineta vaga
total genus 85
structure length 230
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-03-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...