8SAZC

Cryoem structure of dh270.i5.6-ch848.10.17
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
126
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYIHWVRQAPGQGLEWMGWINPNTGRTNSAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGGWIGLYYDSSGYPNFDYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for breadth development in the HIV-1 V3-glycan targeting DH270 antibody clonal lineage.
pubmed doi rcsb
molecule keywords Envelope glycoprotein gp160
molecule tags Viral protein/immune system
source organism Hiv-1 06tg.ht008
total genus 26
structure length 126
sequence length 126
chains with identical sequence H, M
ec nomenclature
pdb deposition date 2023-04-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...