8SDFB

Crystal structure of sars-cov-2 receptor binding domain in complex with neutralizing antibody cc25.4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
227
structure length
217
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYFLHWVRQAPGQGLEWMGWINPDSGGTNYAQRFQGRVTMTRDTSISTAYMEVSRLRSDDTAVYYCARDNERYQMQNYYHYYGMDVWGQGTTVTVVSRRLPPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Spike protein S1
publication title Broadly neutralizing antibodies targeting a conserved silent face of spike RBD resist extreme SARS-CoV-2 antigenic drift
doi rcsb
source organism Severe acute respiratory syndrome coronavirus 2
total genus 42
structure length 217
sequence length 227
chains with identical sequence H
ec nomenclature
pdb deposition date 2023-04-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...