8SH2F

Klhdc2 in complex with elob and eloc
Total Genus 22

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
87
Chain Sequence
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
source organism Homo sapiens
publication title Structure-based discovery and characterization of small molecule ligands and PROTAC degraders that co-opt the E3 ligase KLHDC2 for targeted protein degradation
rcsb
molecule keywords Kelch domain-containing protein 2
total genus 22
structure length 87
sequence length 96
chains with identical sequence H, J, L
ec nomenclature
pdb deposition date 2023-04-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.