8SHTP

Cct g beta 5 complex closed state 14
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
254
structure length
186
Chain Sequence
LAGEGISVNTGPKGVINDWRRFKQLETEQREEQCREMERLIKKLFLQQYRKQRMEEMRQQLHFKQVFEISGEGFLDMIDKEIVIMVHIYEDGTEAMNGCMICLAAEYPAVKFCKVKSSVISQFTRNLLIYKGGELIGNFVRVTDQFFAVDLEAFLQEFGLLPEKLVLTSVRNSATCHSEDSDLEID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the chaperone-mediated folding trajectory of the G protein beta 5 beta-propeller structure
rcsb
molecule tags Chaperone
molecule keywords T-complex protein 1 subunit alpha
total genus 36
structure length 186
sequence length 254
ec nomenclature
pdb deposition date 2023-04-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...