8SIJA

Crystal structure of f. varium tryptophanase
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
460
structure length
445
Chain Sequence
AVKYIPEPFRIKMVEPIKMLTREERIEKIKEANYNLFNLKGADVYIDLLTDSGTNAMSHDQWSGVMRGDEAYAGASSYFRLVDAGKDIFNYGFIQPVHQGRAAEKVLFPTFLSPGKFAISNMFFDTTHVILAGARPICKFKGNMDVEKMEKIILEKGPENIGLIVMTITNNSAGGQPVSMKNIRETSEICKKYGIPFNIDAARYAENAYFIKRDEEGYQNKSIKDIIRETFSYADMFTMSAKKDTIVNMGGLIGVKDPQSPLILKIKANCISYEGFFTYGGLGGRDLEALAIGLYEGIDEDYLKYRNGQMEYLASRLDDAGIAYQAPIGGHGAFIDAKAMFPQIPYNEYPGQVLAIELYIEAGIRTCDIGSYMLGNDPDTGKQLEADFEFTRLAIPRRVYTQSHFDVMADAIIEVSKRAHEIKRGYKIIWEPPILRHFQASLAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism-based inhibition of gut microbial tryptophanases reduces serum indoxyl sulfate.
pubmed doi rcsb
molecule tags Lyase
source organism Fusobacterium varium
molecule keywords Tryptophanase 1
total genus 146
structure length 445
sequence length 460
chains with identical sequence B
ec nomenclature ec 4.1.99.1: tryptophanase.
pdb deposition date 2023-04-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...