8SISH

Crystal structure of sars-cov-2 spike receptor-binding domain in complex with broadly neutralizing antibody cc84.2 fab
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
229
structure length
229
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTRYAMHWVRQAPGQSLECMGWINAGNGNTKYSKNFQGRVTITRDTSANTVYMELSSLRSEDTAVYYCARDLYYYDSSGYQHINYQLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Broadly neutralizing antibodies targeting a conserved silent face of spike RBD resist extreme SARS-CoV-2 antigenic drift
doi rcsb
molecule tags Immune system
source organism Severe acute respiratory syndrome coronavirus 2
molecule keywords Spike protein S1
total genus 32
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2023-04-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...