8SL7A

Butyricicoccus sp. bioml-a1 tryptophanase complex with (3s) alg-05
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
541
structure length
541
Chain Sequence
QYPLNVPAPHHFTYAVRDLPEVTVEQRERALQATHYNEFAFPSGMLTVDMLSDSGTTAMTNHQWASLFLGDEAYGRNTGYYVLLDTFRDIFERGGEKNWKKIIDLVRTDCRDVEKMMDEVYLCEYEGGLFNGGAAQMERPNAFIIQQGRAAESVLMEIVRNILAKRHPGKKFTIPSNGHFDTTEGNIKQMGSIPRNLYNKTLLWETPEGGRYEKNPFKGNMDIEKLEQLIQGVGPENVPLIFTCITNNPVCGQAVSMGNLKEINRVAHKYNIPLVFDTARWAENAYFIKMNEEGYADKSIAEIATEMFSYCDAFTMSAKKDGHANMGGMLAFRDKGLFWKNFSDFNEDGTVKTDVGVLLKVKQISCYGNDSYGGMSGRDIMALAVGLYESCDFNYMNERVAQCNYLAEGFYDAGVKGVVLPAGGHAVYINMDEFFDGKRGHDTFAGEGFSLELIRRYGIRVSELGDYSMEYDLKTPEQQAEVCNVVRFAIDRSRLTKEHLDYVIAAVKALYEDRENIPNMRIVWGHNLPMRHFHAFLEPYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism-based inhibition of gut microbial tryptophanases reduces serum indoxyl sulfate.
pubmed doi rcsb
molecule tags Lyase
source organism Butyricicoccus sp. bioml-a1
molecule keywords Tryptophanase
total genus 209
structure length 541
sequence length 541
chains with identical sequence B, C, D
ec nomenclature ec 4.1.99.1: tryptophanase.
pdb deposition date 2023-04-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...