8SOKE

Cryo-em structure of human cst bound to pot1(esdl)/tpp1 in the presence of telomeric ssdna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
MREDQEHQGALVCLAESCLTLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of CST-Pol alpha /Primase recruitment and regulation by POT1 at telomeres.
pubmed doi rcsb
molecule tags Dna binding protein
source organism Escherichia coli o157:h7
molecule keywords CST complex subunit CTC1
total genus 15
structure length 67
sequence length 67
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2023-04-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...