8SPZA

Crystal structure of bax core domain bh3-groove dimer - hexameric fraction with dioctanoyl phosphatidylserine
Total Genus 31

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
77
structure length
77
Chain Sequence
SDASTKKLSESLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALSTK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
source organism Homo sapiens
publication title Sequence differences between BAX and BAK core domains manifest as differences in their interactions with lipids.
pubmed doi rcsb
molecule keywords Apoptosis regulator BAX
total genus 31
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2023-05-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.