8SQJB

Sars-cov-2 replication-transcription complex bound to rna-nsp9, as a noncatalytic rna-nsp9 binding mode
Total Genus 48
2040608010012014016018001020304050
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
187
structure length
187
Chain Sequence
FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (7-28)AH2 (32-97)EMPTYTI1 (110-113)S5 (184-190)3H1 (177-179)S1 (127-132)AH5 (135-142)TIV2 (148-151)S2 (146-149)S3 (152-161)TI2 (161-164)TI5 (173-176)S4 (165-166)TI3 (168-171)TI4 (169-172)TIV1 (29-32)AH3 (100-109)AH4 (118-124)Updating...
connected with : NaN
molecule tags Viral protein
source organism Severe acute respiratory syndrome coronavirus 2
publication title Structural and functional insights into the enzymatic plasticity of the SARS-CoV-2 NiRAN domain.
pubmed doi rcsb
molecule keywords RNA-directed RNA polymerase
total genus 48
structure length 187
sequence length 187
chains with identical sequence D
ec nomenclature
pdb deposition date 2023-05-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.