8SQQA

Crystal structure of bacterioferritin (bfr) from brucella abortus (apo cubic form 2, f16l mutant)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
160
structure length
160
Chain Sequence
SMKGEPKVIERLNEALLLELGAVNQYWLHYRLLNDWGYTRLAKKEREESIEEMHHADKLIDRIIFLEGFPNLQTVSPLRIGQNVKEVLEADLKGEYDARASYKESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDLLAKIGGERYGQLNAAPADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bacterioferritin (Bfr) from Brucella abortus (Apo Cubic Form 2, F16L mutant)
rcsb
molecule tags Metal binding protein
source organism Brucella abortus 2308
molecule keywords Bacterioferritin
total genus 72
structure length 160
sequence length 160
ec nomenclature ec 1.16.3.1: ferroxidase.
pdb deposition date 2023-05-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...