8SUCA

Nhl-2 nhl domain
Total Genus 58

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
282
structure length
282
Chain Sequence
PRVSDLKVHSVFGTSQQGSTIRELHCPSGFCLSDTDDILIADTNNHRVVVCGPPHPWKIGRPGTDDGQLCFPRKVIALRGEAVRYVVLDKGGDGKTRAQIFEARGEFVKRLNMMALVPRGGIEVSAAAATPNGQLLLVDTAGFVYSIDVDAPRVTFWFDASTQLGEASDVAMFDNLIYITDFKHHCVQVYTSEGKFIRKMGEPSQTPYPIGIDVSKAGEVLVADTHGNHLHVVVFSPEGQHIHSFTHNEFRLSRCVGLRIAKSGHIVTLCKHNHTLFVFKPL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
source organism Caenorhabditis elegans
publication title NHL-2 NHL domain
rcsb
molecule keywords NHL (Ring finger b-box coiled coil) domain containing protein
total genus 58
structure length 282
sequence length 282
ec nomenclature
pdb deposition date 2023-05-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.