8SUWA

E. coli sir2-hera complex (dodecamer sir2 bound 4 protomers of hera)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
406
structure length
398
Chain Sequence
SIYQGGNKLNEDDFRSHVYSLCQLDNVGVLLGAGASVGCGGKTMKDVWKSFKQNYPELLGALIDKYLLVSQIDSDNNLVNVELLIDEATKFLSVAKTRRCEDEEEEFRKILSSLYKEVTKAALLTGEQFREKNQGKKDAFKYHKELISKLISNRQPGQSAPAIFTTNYDLALEWAAEDLGIQLFNGFSGLHTRQFYPQNFDLAFRNVNHYHAYLYKLHGSLTWYQNDSLTVNEVSASQAYDEYINDIINKDDFYRGQHLIYPGANKYSHTIGFVYGEMFRRFGEFISKPQTALFINGFGFGDYHINRIILGALLNPSFHVVIYYPELKEAITKVSKGGGSEAEKAIVTLKNMAFNQVTVVGGGSKAYFNSFVEHLPYPVLFPRDNIVDELVEAIANLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords SIR2-like domain-containing protein
publication title Assembly-mediated activation of the SIR2-HerA supramolecular complex for anti-phage defense.
pubmed doi rcsb
source organism Escherichia coli
total genus 101
structure length 398
sequence length 406
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec ?:
pdb deposition date 2023-05-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...