8SVAA

Structure of the rhodococcus sp. usk13 darr-20 bp dna complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
200
structure length
200
Chain Sequence
ESDVKGRILDAAADAFMLRGFANTTIDDIADDVGATKGLIYYHFRSKFDIFLAVYEDGMRRVRERVEPYVGAPGTGRQRLVAMSVAHVENLMIDLGYHHVVHQGVRDQASTALKVRQRDALAALNELRRDYERMFHHVITEGIADGSLRNVDDALATRTLLSNLNAVDVWYRKIEGQTEKEVHDLASQVVDLLIGGIGAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords TetR/AcrR family transcriptional regulator
publication title Structures of the DarR transcription regulator reveal unique modes of second messenger and DNA binding
rcsb
source organism Rhodococcus
total genus 54
structure length 200
sequence length 200
chains with identical sequence F, G, T
ec nomenclature
pdb deposition date 2023-05-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...