8SVDA

Structure of m. baixiangningiae darr-dna complex reveals novel dimer-of-dimers dna binding
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
197
structure length
194
Chain Sequence
DVKGRILDAAADAFMARGFANTTIDDIADEVGATKGLIYYHFRSKFDIFLAVYEDGMRRVRERVEPHSTAPGTGHQRLEAMSIAHLENLMTELGYHHVVHQGVRHTALKVRQRDALTALNELRRDYERMFRRVIAEGIADGSLRRVDEALATRTLLSNLNAVDVWYRKIEGQTGEEIRELASQVVDMLIGGLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of The DarR transcription regulator reveal unique modes of second messenger and DNA binding
rcsb
molecule keywords DarR
molecule tags Transcription/dna
source organism Mycolicibacterium baixiangningiae
total genus 51
structure length 194
sequence length 197
chains with identical sequence E, F, G, I, J, K, T
ec nomenclature
pdb deposition date 2023-05-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...