8SVFM

Bap1/asxl1 bound to the h2ak119ub nucleosome
Total Genus 14

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
66
Chain Sequence
QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYSTLHLVLR

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS2 (12-15)S1 (3-6)3H2 (56-58)TI2 (18-21)TII1 (51-54)3H1 (38-40)AH1 (23-34)S5 (65-71)S3 (41-45)TIV1 (44-47)S4 (48-50)TI1 (7-10)Updating...
connected with : NaN
molecule tags Nuclear protein/dna/rna
source organism Xenopus laevis
publication title Structural basis of histone H2A lysine 119 deubiquitination by Polycomb repressive deubiquitinase BAP1/ASXL1.
pubmed doi rcsb
molecule keywords Histone H3.2
total genus 14
structure length 66
sequence length 71
ec nomenclature
pdb deposition date 2023-05-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.