8SWRA

Structure of k. lactis pnp s42e variant bound to transition state analog dadme-immucillin g and sulfate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
295
Chain Sequence
DINEQRALIKSAHRYISEKLEDHFSSEFLPKALVICGEGLSGISTKIADEPKPLILSYSTIPGFKSGELIFGYMNGAPVVLMNGRLHSYEGHSLAETVHPIRALHLLGSINVLIVTNAAGGINASFKAGDLMCVYDHINFPGLCGFHPLRGANFDEFGPRFLATSDAYDLELRKLLFSKKKELNIERKIHEGTYSYVHGPTFESRAESRFLRLAGTDAVGMSTVPEVVTARHCGWRVLALSLITNECVVDPPASAHDENPVPIQEGKATHEEVLENSAKASKDVQELIFSVVAEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphate Binding in PNP Alters Transition-State Analogue Affinity and Subunit Cooperativity.
pubmed doi rcsb
molecule tags Transferase
source organism Kluyveromyces lactis nrrl y-1140
molecule keywords Purine nucleoside phosphorylase
total genus 90
structure length 295
sequence length 302
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: purine-nucleoside phosphorylase.
pdb deposition date 2023-05-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...