8SWTA

Structure of bacteroides fragilis pnp bound to transition state analog immucillin h and sulfate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
278
structure length
278
Chain Sequence
NLYFQSMMAMLEKIQETAAFLKGKMHTSPETAIILGTGLGSLANEITEKYEIKYEDIPNFPVSTVEGHSGKLIFGKLGNKEIMAMQGRFHYYEGYSMKEVTFPVRVMRELGIKTLFVSNASGGTNPEFEIGDLMIITDHINYFPEHPLRGKNIPYGPRFPDMSEAYDKELIRKADAIAAEKGIKVQHGIYIGTQGPTFETPAEYKLFHILGADAVGMSTVPEVIVANHCGIKVFGISVVTDLGVEGKIVEVSHEEVQKAADAAQPKMTTIMRELINRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphate Binding in PNP Alters Transition-State Analogue Affinity and Subunit Cooperativity.
pubmed doi rcsb
molecule tags Transferase
source organism Bacteroides fragilis nctc 9343
molecule keywords Purine nucleoside phosphorylase
total genus 97
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 2.4.2.1: purine-nucleoside phosphorylase.
pdb deposition date 2023-05-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...