8T0BA

Novel domain of unknown function solved with alphafold
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
131
structure length
121
Chain Sequence
LRVGLFPVRYLVGTGLPGAPQLVLDLMVDTVDHSVVGRAAVSQAVSPPLNFHADVWGSYVFRLAIVQISLQGNQGGPQSNSMITFYGELLLKGDGKTGVASYRYYSNGSWHEVENVPVKAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords DUF1842 domain-containing protein
publication title AlphaFold-Assisted Structure Determination of a Bacterial Protein of Unknown Function Using X-ray and Electron Crystallography
rcsb
source organism Burkholderia pseudomallei
total genus 21
structure length 121
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-05-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...