8T0MH

Proteasome 20s core particle from pre1-1 pre4-1 double mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
196
structure length
183
Chain Sequence
TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYEGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the preholoproteasome reveals late steps in proteasome core particle biogenesis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit alpha type-1
total genus 51
structure length 183
sequence length 196
chains with identical sequence V
ec nomenclature ec 3.4.25.1: proteasome endopeptidase complex.
pdb deposition date 2023-06-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...