8T0OH

Fab from mab rb2at_87
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
217
structure length
217
Chain Sequence
QSVKESEGGLFKPTDTLTLTCTVSGFSLSSNAISWVRQAPGNGLEWIGTIGGSGNTYYASWAKSRSTITRNTNENTVTLKMTSLTAADTATYFCARDSATTDSNIWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords RB2AT_87 Fab Light chain
publication title Generation and Study of Antibodies against Two Triangular Trimers Derived from Abeta
doi rcsb
source organism Oryctolagus cuniculus
total genus 33
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2023-06-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...