8T4DA

Md65 n332-gt5 sosip in complex with rm_n332_08 fab and rm20a3 fab
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
470
structure length
434
Chain Sequence
NLWVTVYYGVPVWKDAETTLFCASDHNVWATHACVPTDPNPQEIHLENVTEEFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLQCTNYAPKLRSMMRGEIKNCSFNMTTELRDKKQKVYSLFYRLDVVQINNKEYRLINCNTSAITQACPKVSFEPIPIHYCAPAGFAILKCKDKKFNGTGPCQNVSTVQCTHGIKPVVSTQLLLNGSLAEEEVIIRSENITNNAKNILVQLNTSVQINCTRPSNNTVKSIRIGPGQAFYYFGDVLGHVRMAHCNISKATWNETLGKVVKQLRKHFGNNTIIRFAQSSGGDLEVTTHSFNCGGEFFYCNTSGLFNSTWISDSLILPCWIKQIINMWQRIGQAMYAPPIQGVIRCVSNITGLILTRDSTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Vaccine priming of rare HIV broadly neutralizing antibody precursors in nonhuman primates
doi rcsb
molecule tags Viral protein/immune system
source organism Human immunodeficiency virus 1
molecule keywords MD65 N332-GT5 SOSIP gp120
total genus 103
structure length 434
sequence length 470
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2023-06-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...