8T4Sb

Mers-cov nsp1 protein bound to the human 40s ribosomal subunit
Total Genus 9

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
82
structure length
82
Chain Sequence
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TIV1 (2-5)AH1 (12-17)TVIII1 (7-10)EMPTYTI3 (20-23)TI2 (19-22)TVIII2 (23-26)S2 (43-47)S6 (78-81)S1 (32-36)TII1 (74-77)TIV3 (67-70)S3 (54-55)TI5 (56-59)S5 (72-73)S4 (62-65)Updating...
connected with : NaN
molecule tags Ribosome/viral protein
source organism Middle east respiratory syndrome-related coronavirus
publication title Structural basis for translation inhibition by MERS-CoV Nsp1 reveals a conserved mechanism for betacoronaviruses.
pubmed doi rcsb
molecule keywords 18S rRNA
total genus 9
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2023-06-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.