8T8OAB

Ccw flagellar switch complex - flif, flig, flim, and flin forming 34-mer c-ring from salmonella
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
GDVSGAMQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Motor protein
molecule keywords Flagellar M-ring protein
publication title Structural basis for directional rotation of the Salmonella flagellum
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 12
structure length 93
sequence length 93
chains with identical sequence AC, AE, AF, BB, BE, CA, CB, CD, CE, CG, D, DA, DD, DG, E, EA, EC, ED, EF, EG, FC, FF, GB, GC, GE, GF, H, HB, HE, IA, IB, ID, IE, IG, JA, JD, JG, KA, KC, KD, KF, KG, L, LC, LF, MB, MC, ME, MF, N, NB, NE, O, OA, OB, OD, OE, OG, P, PA, PD, PG, Q, QA, QC, QD, QF, QG, R, RC, RF, SB, SC, SE, SF, TB, TE, UA, UB, UD, UE, UG, VA, VD, VG, W, WA, WC, WD, WF, WG, X, XC, XF, Y, YB, YC, YE, YF, ZB, ZE
ec nomenclature ec ?:
pdb deposition date 2023-06-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...