8TEKB

Baseplate of nexin-dynein regulatory complex from tetrahymena thermophila
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
228
structure length
208
Chain Sequence
FYHAHNKNRKQEIDRYLRTISSKKAKIDLMKLKILQHCKEFNARNSALKKEKENISRNYHELKLKMQKFREEESRRLKELSNNSRNAVLKLREYCALGEKILKTAELCRRLETEKEKVLPFYEKEDAEEYAYLNNFYKRYNKVLLDKLAIEKQKENLQRDNQLLKSLLKQYLDGISLNDDVLKNENNPLLVVNHKFNLGKMPVEKIEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Integrated modeling of the Nexin-dynein regulatory complex reveals its regulatory mechanism.
pubmed doi rcsb
molecule tags Protein binding
molecule keywords Dynein regulatory complex protein 1/2 N-terminal domain-containing protein
total genus 61
structure length 208
sequence length 228
ec nomenclature
pdb deposition date 2023-07-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...