8TFLL

Ricin in complex with fab sylh3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
205
Chain Sequence
DIVMTQSPSSLSASLGGRVTITCKASQDIKKYIGWYQHRPGKGPRLLIHYTSTLQPGIPSRFSGGGSGRDYSFNISNLEPEDIATYYCLQYDHLWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Antibody-Mediated Inhibition of Ricin Toxin Attachment to Host Cells.
pubmed doi rcsb
molecule keywords SylH3 Fab light chain
molecule tags Toxin
source organism Mus musculus
total genus 48
structure length 205
sequence length 210
ec nomenclature
pdb deposition date 2023-07-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...