8TH2A

Structure of the isoflavene-forming dirigent protein pspts2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
169
structure length
160
Chain Sequence
TYYQDISPSFLGFKQEKLTHIHFFLHDIVTGPKPTMIIASESPLNGKSESPLPFGSIVVLEDPLTVGPELNSELIGKAQGFYVTVSQAAVLELELVMGMTFVFTGGKYNGSTLSVLGRNEIISPIREMPIIGGTGEFRFARGFLQAKSAHVEYNVYVFHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Plant protein
molecule keywords Dirigent protein
publication title Dirigent isoflavene-forming PsPTS2: 3D Structure, stereochemical and kinetic characterization comparison with pterocarpan-forming PsPTS1 homolog in pea.
pubmed doi rcsb
source organism Pisum sativum
total genus 27
structure length 160
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2023-07-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...