8TKPB

Structure of the c. elegans tmc-2 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
187
structure length
187
Chain Sequence
SKGGVFTREQLDEYQDCTFFTRKDIIRLYKRFYALNPHKVPTNMQGNRPAITTLTFEEVEKMPELKENPFKRRICEVFSEDGRGNLSFDDFLDMFSVFSEMAPLQLKLKYAFRIYDYDGDELLGHDDLSKMIRSLTRDELSDVEVEFIIERIIEEADLDGDSSINFAEFEHVVSRSPDFIRTFHIRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Transmembrane channel-like protein 2
publication title The structure of the Caenorhabditis elegans TMC-2 complex suggests roles of lipid-mediated subunit contacts in mechanosensory transduction.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 55
structure length 187
sequence length 187
chains with identical sequence E
ec nomenclature ec ?:
pdb deposition date 2023-07-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...