8TLQD

Cryo-em structure of the rev1-polzeta-dna-dctp complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
243
structure length
184
Chain Sequence
MNRWVEKWLRVYLKCYINLILFYRNVYPPQSFDYTTYQSFNLPQFVPINRHPALIDYIEELILDVLSKLTHVYRFSICIINKKNDLCIEKYVLDFSELQIITETEVFDEFRSSLNSLIMHLEKLPKVNDDTITFEAVINAIENWVKCKIKLTSLVGSDVGPLIIHQFSEKLLNGVYSQYSIFGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of the Rev1-Polzeta holocomplex reveals the mechanism of their cooperativity in translesion DNA synthesis
rcsb
molecule tags Dna binding protein/dna
source organism Saccharomyces cerevisiae
molecule keywords DNA polymerase zeta catalytic subunit
total genus 36
structure length 184
sequence length 243
chains with identical sequence E
ec nomenclature
pdb deposition date 2023-07-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...