8TN1A

De novo designed protein binds poly adp ribose polymerase inhibitors (parpi) - apo
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
147
structure length
147
Chain Sequence
SDAQEILSRLNSVLEAAWKTILNLASATDAAEKAYKEGREEDLATYLDQAASYQSQVDQYAVETVRLLAELKKVFPDEEADRALQIAEKLLKTVQEASKTLDTAVAAAANGDEETFAKAFNQFVSLGNQADTLFTQLQRTLTNLNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title De novo design of drug-binding proteins with predictable binding energy and specificity.
pubmed doi rcsb
molecule tags De novo protein
source organism Synthetic construct
molecule keywords De novo designed 4 helix bundles
total genus 67
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2023-08-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...