8TNGH

Cryo-em structure of hiv-1 env bg505 ds-sosip in complex with broadly neutralizing llama nanobody r27 targeting the cd4-binding site
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCVASGFDLENYSIGWFRQAPGKAREGVACLSKNSGIGHSVKGRFTISRDGDSNTWFLQMGALEAEDTAVYTCATYNRACANYVTIWPEFRGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of HIV-1 Env BG505 DS-SOSIP in complex with broadly neutralizing llama nanobody R27 targeting the CD4-binding site
rcsb
molecule tags Viral protein/immune system
source organism Human immunodeficiency virus 1
molecule keywords HIV-1 BG505 DS-SOSIP gp120
total genus 14
structure length 121
sequence length 121
chains with identical sequence I, J
ec nomenclature
pdb deposition date 2023-08-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...