8TNLA

Cryoem structure of h7 hemagglutinin from a/shanghai2/2013 h7n9 in complex with a human neutralizing antibody h7.hk1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
QVQLQESGPGLVKPSETLSLTCSVSGGSINSYYWTWIRQPPGKGLEWVGYIYHSGSTSYNPSLKSRITISVAPSKNHFSLELTSMTAADTAVYYCARLGGHGDYGSDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CryoEM structure of H7 hemagglutinin from A/Shanghai2/2013 H7N9 in complex with a human neutralizing antibody H7.HK1
rcsb
molecule keywords H7.HK1 Neutralizing Antibody Heavy Chain
molecule tags Viral protein/immune system
source organism Homo sapiens
total genus 14
structure length 119
sequence length 119
chains with identical sequence D, H
ec nomenclature
pdb deposition date 2023-08-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...