8TOAB

Cryoem structure of h7 hemagglutinin from a/shanghai2/2013 h7n9 in complex with a human neutralizing antibody h7.hk2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
DIVMTQSPLSLPVTPGEPASISCRSNQSLQHSNGYVHLDWYRQKPGQSPHLLIYLGFNRASGVPDRFSGGGSGTDFTLKISRVEAEDVGVYYCMQGLQTPFTFGPGTTVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CryoEM structure of H7 hemagglutinin from A/Shanghai2/2013 H7N9 in complex with a human neutralizing antibody H7.HK1
rcsb
molecule tags Viral protein/immune system
source organism Homo sapiens
molecule keywords H7.HK2 Neutralizing Antibody Heavy Chain
total genus 16
structure length 111
sequence length 111
chains with identical sequence E, L
ec nomenclature
pdb deposition date 2023-08-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...