8TP9F

H2 hemagglutinin (a/singapore/1/1957) in complex with medial-junction-targeting fab 2-2-1g06
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASHNIQNFLNWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSRTDFTLTISSLQPEDFAAYYCQQSYGLPRTFGQGTRLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Immune memory shapes human polyclonal antibody responses to H2N2 vaccination.
pubmed doi rcsb
molecule keywords Hemagglutinin
molecule tags Viral protein/immune system
source organism Influenza a virus (a/singapore/1/1957(h2n2))
total genus 26
structure length 107
sequence length 107
chains with identical sequence G, L
ec nomenclature
pdb deposition date 2023-08-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...