8TPJA

Top cylinder bound to ocp from high-resolution phycobilisome quenched by ocp (local refinement)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
VTPRFVELGQVSAIRTEPEIAYRSNQGVTRQRQQTKVFKLVSTYDKVAVKNAIRAAYRQVFERDLEPYIINSEFTALESKLSNNEINVKEFIEGLGTSELYMKEFYAPYPNTKVIEMGTKHFLGRAPLNQKEIQQYNQILASQGLKAFIGAMVNGMEYLQTFGEDTVPYRRFPTLPAANFPNTERLYNKLTKQDKELVVPSFTPVVKVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Photosynthesis
molecule keywords Phycobiliprotein ApcE
publication title Structural and quantum chemical basis for OCP-mediated quenching of phycobilisomes.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 66
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2023-08-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...