8TPKA

P6522 crystal form of c. crescentus drid-ssdna-dna complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
326
structure length
319
Chain Sequence
RHEKATRLLDLARMLAGSAEGLTLDEMAAALGVGRRTAERMRDAVWAAFPQMEAIDDPPTKRFRIPQTPTAEELAALRVAADSLRASGADARASSLYALEAKLLSALRGSARRRVAPDVEALVQAETIAVHAGPRPYEDQAVLGAIRAAIKGLQALSFRYEGGSTPGRTREVTPLGVLFGRSNYLVALEGKGGKPRSWRLDRMSDLKVLDKPAPPPQDFSLQAFADESFGIYHDEIQDVVLRIHKSRAEDALRWRFHATQQVTPEADGSVLVTFRAGGMRELSWHLFTWGDAVEIVAPQVLKDMMVQELREAGRAHGAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DeoR-family transcriptional regulator
publication title Structure of the WYL-domain containing transcription activator, DriD, in complex with ssDNA effector and DNA target site
rcsb
source organism Caulobacter vibrioides
total genus 63
structure length 319
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-08-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...