8TXYA

X-ray crystal structure of jrd-sik1/2i-3 bound to a mark2-sik2 chimera
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
316
structure length
305
Chain Sequence
PHIGNYRLLKTLGKGNFAVVKLARHILTGKEVAIKIIDKTQLNSSSLQKIFREVRIMKVLNHPNIIKLFEVIETEKTLYLVTEYAKNGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of highly selective SIK1/2 inhibitors that modulate innate immune activation and suppress intestinal inflammation.
pubmed doi rcsb
molecule tags Biosynthetic protein
source organism Homo sapiens
molecule keywords Serine/threonine-protein kinase MARK2
total genus 95
structure length 305
sequence length 316
chains with identical sequence B
ec nomenclature ec 2.7.11.1: non-specific serine/threonine protein kinase.
pdb deposition date 2023-08-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...