8TZCB

Structure of c-terminal lrrk2 bound to mli-2 (g2019s mutant)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
143
structure length
125
Chain Sequence
GKKLLEAARATDEAGVTPLHLAADSGHLEIVEVLLKTGADVNAWDHYGFTPLHLAAHVGHLEIVEVLLKAGADVNAQDHAGWTPLHLAALYGHLEIVEVLLKHGADVNAQDMWGETPFDLAIDNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Parkinson Disease-related LRRK2 by Type I and Type II kinase inhibitors:activity and structures
rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Leucine-rich repeat serine/threonine-protein kinase 2
total genus 25
structure length 125
sequence length 143
ec nomenclature
pdb deposition date 2023-08-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...