8TZHB

Structure of full-length lrrk2 bound to mli-2 (i2020t mutant)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
121
Chain Sequence
TDEAGVTPLHLAADSGHLEIVEVLLKADVNAWDHYGFTPLHLAAHVGHLEIVEVLLKAGADVNAQDHAGWTPLHLAALYGHLEIVEVLLKHGVNAQDMWGETPFDLAIDNGNEDIAEVLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Parkinson Disease-related LRRK2 by Type I and Type II kinase inhibitors:activity and structures
rcsb
molecule tags Protein binding
source organism Synthetic construct
molecule keywords E11 DARPin
total genus 32
structure length 121
sequence length 125
ec nomenclature
pdb deposition date 2023-08-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...