8TZUC

Oc43 s1b domain in complex with wnb 293 and wnb 317
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASVRTFSNYAMGWFRQAPGKEREFVAAISWSGDGPYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASYLSLNFPDDLRGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Spike protein S1
publication title OC43 S1b domain in complex with WNb 293 and WNb 317
rcsb
source organism Human coronavirus oc43
total genus 28
structure length 120
sequence length 120
chains with identical sequence G, H
ec nomenclature
pdb deposition date 2023-08-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...