8U4TG

Structure of tetrameric cxcr4 in complex with regn7663 fab
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
125
structure length
125
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGIEWMGWISTYNGNRNYAQKVQGRVTMTTDRSTSTAYMDLRSLRSDDTAVYYCARHGITGARNYYYHYGMDVWGQGTTVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/immune system
source organism Homo sapiens
publication title Structural insights into CXCR4 modulation and oligomerization
doi rcsb
molecule keywords REGN7663 Fab light chain
total genus 23
structure length 125
sequence length 125
chains with identical sequence H, P, Z
ec nomenclature
pdb deposition date 2023-09-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...