8U51A

Klebsiella pneumoniae sumo-loaded encapsulin shell
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
267
structure length
267
Chain Sequence
MNNLHRELAPVSDAAWEQIEEEASRTLKRFLAARRVVDVSDPQGPAFSAVGTGHVTRLEGPGDSVGAVKRQSQPVVEFRVPFILTRQAIDDVERGSQDSDWSPLKEAARKIAGAEDRAVFDGYAAAGIGGIRPQSSNSPLTLPVAASGYPDVIARALDQLRVAGVNGPYHLVLGENAYTLITSGNEDGYPVLQHIHRLIDGEIVWAPAIEGGVLLSTRGGDFAMDIGQDISIGYLSHTATHVELYLQESFTFRTLTSEAVVSLLPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for peroxidase encapsulation inside the encapsulin from the Gram-negative pathogen Klebsiella pneumoniae.
pubmed doi rcsb
molecule tags Virus like particle
source organism Klebsiella pneumoniae
molecule keywords Klebsiella pneumoniae family 1 encapsulin shell
total genus 64
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2023-09-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...